Proteintech, 15170-1-AP, CRAT Polyclonal antibody

Size: 20ul / 150ul The CRAT (15170-1-AP) by Proteintech is a Polyclonal antibody targeting CRAT in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 15170-1-AP targets CRAT in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue, mouse heart tissue, rat skeletal muscle, rat heart tissue Positive IP detected in: mouse skeletal muscle tissue Positive IHC detected in: mouse brain tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:800-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information CRAT, also named as CAT1, belongs to the carnitine/choline acetyltransferase family. It is specific for short chain fatty acids. CRAT seems to affect the flux through the pyruvate dehydrogenase complex. It may be involved as well in the transport of acetyl-CoA into mitochondria. Carnitine palmitoyltransferase (CPT) deficiencies are common disorders of mitochondrial fatty acid oxidation. The CPT system is made up of two separate proteins located in the outer (CPT1) and inner (CPT2) mitochondrial membranes. CRAT is an active forms for carnitine acetyltransferase. This antibody can bind the close sequences genes. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, sheep, goat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7422 Product name: Recombinant human CRAT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-281 aa of BC000723 Sequence: MLAFAARTVVKPLGFLKPFSLMKASSRFKAHQDALPRLPVPPLQQSLDHYLKALQPIVSEEEWAHTKQLVDEFQASGGVGERLQKGLERRARKTENWLSEWWLKTAYLQYRQPVVIYSSPGVMLPKQDFVDLQGQLRFAAKLIEGVLDFKVMIDNETLPVEYLGGKPLCMNQYYQILSSCRVPGPKQDTVSNFSKTKKPPTHITVVHNYQFFELDVYHSDGTPLTADQIFVQLEKIWNSSLQTNKEPVGILTSNHRNSWAKAYNTLIKDKVNRDSVRSIQK Predict reactive species Full Name: carnitine acetyltransferase Calculated Molecular Weight: 71 kDa Observed Molecular Weight: 62-68 kDa GenBank Accession Number: BC000723 Gene Symbol: CRAT Gene ID (NCBI): 1384 RRID: AB_2229978 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P43155 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.