Proteintech, 15204-1-AP, CHOP/GADD153 Polyclonal antibody

Size: 20ul / 150ul The CHOP/GADD153 (15204-1-AP) by Proteintech is a Polyclonal antibody targeting CHOP/GADD153 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 15204-1-AP targets CHOP/GADD153 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Tunicamycin treated HeLa cells, MCF-7 cells, HeLa cells, K-562 cells, RAW 264.7 cells Positive IP detected in: C6 cells Positive IHC detected in: human colon cancer tissue, human breast cancer tissue, human thyroid cancer tissue, human cervical cancer tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Tunicamycin treated HeLa cells Positive FC (Intra) detected in: Tunicamycin treated HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information CHOP, also known as GADD153 or DDIT3, is a highly conserved gene in both the structural and regulatory regions. Imposed by unfolded and misfolded proteins, CHOP is significantly induced by ER stress. CHOP is considered a proapoptotic marker of ER stress dependent cell death. CHOP acts as a dominant-negative inhibitor of the transcription factor C/EBP and LAP. It may play an important role in the malignant transformation of nevus to melanoma. The calculated molecular weight of CHOP is 19 kDa, but the protein migrates on an SDS-PAGE gel with an observed molecular mass of 29 kDa (PMID: 1547942). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, rabbit, canine, chicken, zebrafish, bovine, hamster Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7354 Product name: Recombinant human CHOP; GADD153 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-169 aa of BC003637 Sequence: MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA Predict reactive species Full Name: DNA-damage-inducible transcript 3 Calculated Molecular Weight: 19 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC003637 Gene Symbol: CHOP Gene ID (NCBI): 1649 RRID: AB_2292610 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P35638 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.