Proteintech, 15210-1-AP, DAZAP2 Polyclonal antibody

Size: 20ul / 150ul The DAZAP2 (15210-1-AP) by Proteintech is a Polyclonal antibody targeting DAZAP2 in WB, ELISA applications with reactivity to human, mouse, rat samples 15210-1-AP targets DAZAP2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A375 cells, C6 cells, J774A.1 cells, RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information DAZAP2, also named KIAA0058, has six isoforms. In unstressed cells, it promotes SIAH1-mediated polyubiquitination and degradation of the serine/threonine-protein kinase HIPK2, probably by acting as a loading factor that potentiates complex formation between HIPK2 and ubiquitin ligase SIAH1. In response to DNA damage, it localizes to the nucleus following phosphorylation by HIPK2 and modulates the expression of a subset of TP53/p53 target genes by binding to TP53 at target gene promoters (PMID: 33591310). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7364 Product name: Recombinant human DAZAP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-168 aa of BC002334 Sequence: MNSKGQYPTQPTYPVQPPGNPVYPQTLHLPQAPPYTDAPPAYSELYRPSFVHPGAATVPTMSAAFPGASLYLPMAQSVAVGPLGSTIPMAYYPVGPIYPPGSTVLVEGGYDAGARFGAGATAGNIPPPPPGCPPNAAQLAVMQGANVLVTQRKGNFFMGGSDGGYTIW Predict reactive species Full Name: DAZ associated protein 2 Calculated Molecular Weight: 17 kDa Observed Molecular Weight: 17 kDa, 22 kDa GenBank Accession Number: BC002334 Gene Symbol: DAZAP2 Gene ID (NCBI): 9802 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15038 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.