Iright
BRAND / VENDOR: Proteintech

Proteintech, 15258-1-AP, GSG1 Polyclonal antibody

CATALOG NUMBER: 15258-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GSG1 (15258-1-AP) by Proteintech is a Polyclonal antibody targeting GSG1 in WB, IF-P, ELISA applications with reactivity to human, mouse samples 15258-1-AP targets GSG1 in WB, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse testis tissue Positive IF-P detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information GSG1 causes the redistribution of PAPOLB from the cytosol to the endoplasmic reticulum. It has eight isoforms with MW 31-33 kDa and 36-40 kDa. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7200 Product name: Recombinant human GSG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-282 aa of BC001796 Sequence: MELSKAFSGQRTLLSAILSMLSLSFSTTSLLSNYWFVGTQKVPKPLCEKGLAAKCFDMPVSLDGDTNTSTQEVVQYNWETGDDRFSFRSFRSGMWLSCEETVEEPGERCRSFIELTPPAKRGEKGLLEFATLQGPCHPTLRFGGKRLMEKASLPSPPLGLCGKNPMVIPGNADHLHRTSIHQLPPATNRLATHWEPCLWAQTERLCCCFLCPVRSPGDGGPHDVFTSLPSDCQLGSRRLETTCLELWLGLLHGLALLHLLHGVGCHHLQHVHQDGAGVQVQA Predict reactive species Full Name: germ cell associated 1 Calculated Molecular Weight: 37 kDa Observed Molecular Weight: 39 kDa GenBank Accession Number: BC001796 Gene Symbol: GSG1 Gene ID (NCBI): 83445 RRID: AB_3085457 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q2KHT4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924