Proteintech, 15275-1-AP, VAPA Polyclonal antibody

Size: 20ul / 150ul The VAPA (15275-1-AP) by Proteintech is a Polyclonal antibody targeting VAPA in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 15275-1-AP targets VAPA in WB, IHC, IF/ICC, IP, COIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, HEK-293 cells, mouse skeletal muscle tissue, human kidney tissue, human brain tissue, mouse kidney tissue, mouse liver tissue, rat liver tissue Positive IP detected in: HEK-293 cells Positive IHC detected in: human colon cancer tissue, human liver cancer tissue, mouse brain tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:1600 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information VAPA (Vesicle-associated membrane protein-associated protein A), also known as VAP33, is a ubiquitously expressed integral membrane protein of the VAMP-associated protein (VAP) family. It is present in the plasma membrane and in intracellular vesicles, playing a role in vesicle trafficking. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7393 Product name: Recombinant human VAPA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-221 aa of BC002992 Sequence: MASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFR Predict reactive species Full Name: VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 28-30 kDa GenBank Accession Number: BC002992 Gene Symbol: VAPA Gene ID (NCBI): 9218 RRID: AB_2256991 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9P0L0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.