Proteintech, 15298-1-AP, GRB14 Polyclonal antibody

Size: 20ul / 150ul The GRB14 (15298-1-AP) by Proteintech is a Polyclonal antibody targeting GRB14 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15298-1-AP targets GRB14 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: DU 145 cells Positive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information GRB14 belongs to the GRB7/10/14 family. It is an adapter protein which modulates coupling of cell surface receptor kinases with specific signaling pathways. GRB14 is a target for a PDGF regulated serine kinase, an interaction that does not require PDGFR-GRB14 association. GRB14 is about 58-65kd in WB test. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7554 Product name: Recombinant human GRB14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 225-540 aa of BC053559 Sequence: LQMFLSSSTYPEIHGFLHAKEQGKKSWKKIYFFLRRSGLYFSTKGTSKEPRHLQFFSEFGNSDIYVSLAGKKKHGAPTNYGFCFKPNKAGGPRDLKMLCAEEEQSRTCWVTAIRLLKYGMQLYQNYMHPYQGRSGCSSQSISPMRSISENSLVAMDFSGQKSRVIENPTEALSVAVEEGLAWRKKGCLRLGTHGSPTASSQSSATNMAIHRSQPWFHHKISRDEAQRLIIQQGLVDGVFLVRDSQSNPKTFVLSMSHGQKIKHFQIIPVEDDGEMFHTLDDGHTRFTDLIQLVEFYQLNKGVLPCKLKHYCARIAL Predict reactive species Full Name: growth factor receptor-bound protein 14 Calculated Molecular Weight: 61 kDa Observed Molecular Weight: 61 kDa GenBank Accession Number: BC053559 Gene Symbol: GRB14 Gene ID (NCBI): 2888 RRID: AB_2112892 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14449 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.