Proteintech, 15314-1-AP, TSPAN14 Polyclonal antibody

Size: 20ul / 150ul The TSPAN14 (15314-1-AP) by Proteintech is a Polyclonal antibody targeting TSPAN14 in WB, ELISA applications with reactivity to human samples 15314-1-AP targets TSPAN14 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information TSPAN14 is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Tetraspanins have been involved in diverse processes such as cell activation and proliferation, adhesion and motility, differentiation, and cancer. TSPAN14 belongs to the TSPANC8 subfamily, which also include TSPAN5, TSPAN10, TSPAN15, TSPAN17, and TSPAN33. It has been reported that TSPANC8 tetraspanins interact with ADAM10 and have a conserved function in the regulation of ADAM10 trafficking and activity, thereby positively regulating Notch receptor activation (PMID: 23091066; 23035126). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7551 Product name: Recombinant human TSPAN14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 97-219 aa of BC002920 Sequence: LFQDWVRDRFREFFESNIKSYRDDIDLQNLIDSLQKANQCCGAYGPEDWDLNVYFNCSGASYSREKCGVPFSCCVPDPAQKVVNTQCGYDVRIQLKSKWDESIFTKGCIQALESWLPRNIYIV Predict reactive species Full Name: tetraspanin 14 Calculated Molecular Weight: 31 kDa Observed Molecular Weight: 31 kDa GenBank Accession Number: BC002920 Gene Symbol: TSPAN14 Gene ID (NCBI): 81619 RRID: AB_2918039 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NG11 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.