Iright
BRAND / VENDOR: Proteintech

Proteintech, 15354-1-AP, MYL9 Polyclonal antibody

CATALOG NUMBER: 15354-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MYL9 (15354-1-AP) by Proteintech is a Polyclonal antibody targeting MYL9 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 15354-1-AP targets MYL9 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse colon tissue, Caco-2 cells, rat colon tissue Positive IHC detected in: human liver cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse heart tissue Positive IF/ICC detected in: MCF-7 cells, C2C12 cells Recommended dilution Western Blot (WB): WB : 1:500-1:5000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Myosin regulatory light polypeptide 9 (MYL9), also known as MLC2, belongs to the myosin regulatory subunits. It plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation at Thr19 and Ser20. Implicated in cytokinesis, receptor capping, and cell locomotion (PMID:11942626, PMID:2526655). Some studies have demonstrated that MYL9 may play important roles in various human cancers. The expression and phosphorylation of MYL9 (Thr19/Ser20) may be increased in human breast (PMID: 22144583) and liver cancers (PMID: 18648664), while decreased in human colon (PMID: 22752057) and bladder cancers (PMID: 21139803). MYL9 was the only gene differentially expressed in the aged versus young injured arteries in the rat smooth muscle cell layers (PMID:22003410). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7600 Product name: Recombinant human MYL9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC002648 Sequence: MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD Predict reactive species Full Name: myosin, light chain 9, regulatory Calculated Molecular Weight: 20 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC002648 Gene Symbol: MYL9 Gene ID (NCBI): 10398 RRID: AB_2147773 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P24844 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924