Proteintech, 15448-1-AP, HOXC8 Polyclonal antibody

Size: 20ul / 150ul The HOXC8 (15448-1-AP) by Proteintech is a Polyclonal antibody targeting HOXC8 in WB, ELISA applications with reactivity to human samples 15448-1-AP targets HOXC8 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: COLO 320 cells, MDA-MB-453s cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information HOXC8 belongs to highly conserved subgroup of 39 genes housed into four clusters HOXA-HOXD within the superfamily of homeobox genes. HOX genes encode homeodomain- transcription factors that are responsible for regulating morphogenesis through axial patterning during embryogenesis. Homeobox C8 (HOXC8) is a transcription factor preferentially overexpressed in a large percentage of non-small cell lung carcinoma (NSCLC). HOXC8 participates NSCLC development by controlling CASP1 expression and pyroptosis (PMID: 40701951). Specification Tested Reactivity: human Cited Reactivity: human, mouse, chicken, sheep Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7675 Product name: Recombinant human HOXC8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-242 aa of BC053898 Sequence: MSSYFVNPLFSKYKAGESLEPAYYDCRFPQSVGRSHALVYGPGGSAPGFQHASHHVQDFFHHGTSGISNSGYQQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANTNSSEGQGHLNQNSSPSLMFPWMRPHAPGRRSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKLPGARDEEKVEEEGNEEEEKEEEEKEENKD Predict reactive species Full Name: homeobox C8 Calculated Molecular Weight: 27 aa, 7 kDa Observed Molecular Weight: 33-38 kDa GenBank Accession Number: BC053898 Gene Symbol: HOXC8 Gene ID (NCBI): 3224 RRID: AB_2878140 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P31273 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.