Proteintech, 15509-1-AP, SPO11 Polyclonal antibody

Size: 20ul / 150ul The SPO11 (15509-1-AP) by Proteintech is a Polyclonal antibody targeting SPO11 in WB, ELISA applications with reactivity to human, mouse samples 15509-1-AP targets SPO11 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse testis tissue, human testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Spo11 is a protein used in a complex along with Mre11 and Rad50 during meiotic recombination. It is also involved in the creation of double stranded breaks in the DNA in the early stages of this process. Several transcript variants encoding different isoforms have been found for this gene. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4340 Product name: Recombinant human SPO11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-358 aa of BC033591 Sequence: MAFAPMGPEASFFDVLDRHRESLLAALRRGGREPPTGGSRLASRFEDSVGLQMVSHCTTRKIKSDSPKSAQKFSLILKILSMIYKLVQSNTYATKRDIYYTDSQLFGNQTVVDNIINDISCMLKVSRRSLHILSTSKGLIAGNLRYIEEDGTKVNCTCGATAVAVPSNIQGIRNLVTDAKFVLIVEKDATFQRLLDDNFCNKLSPCIMITGKGVPDLNTRLLVKKLWDTFHVPVFTLVDADPHGIEIMCIYKYGSMSMSFEAHHLTVPAIRWLGLLPSDLKRLNVPKDSLIPLTKRDQMKLDSILRRPYVTCQPFWRKEMEIMADSKMKAEIQALTFLSSDYLSRVYLPNKLKFGGWI Predict reactive species Full Name: SPO11 meiotic protein covalently bound to DSB homolog (S. cerevisiae) Calculated Molecular Weight: 45 kDa Observed Molecular Weight: 55-70 kDa GenBank Accession Number: BC033591 Gene Symbol: SPO11 Gene ID (NCBI): 23626 RRID: AB_10639508 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y5K1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.