Proteintech, 15554-1-AP, PHF5A Polyclonal antibody

Size: 20ul / 150ul The PHF5A (15554-1-AP) by Proteintech is a Polyclonal antibody targeting PHF5A in WB, IP, ELISA applications with reactivity to human, mouse samples 15554-1-AP targets PHF5A in WB, IHC, IF, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells Positive IP detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information The PHD finger-like domain protein 5a (PHF5A) is ubiquitously expressed and is located in the nucleus. The gene Phf5a and its human counterpart PHF5A (former name Ini) are located on rat chromosome 7 (RNO7q34) and human chromosome 22 (HSA2213q2), respectively. The rat gene consists of four exons, while the human gene have five exons. Both genes encode a highly conserved protein of 110 amino acids that contains a PHD finger domain.(PMID: 23675859) It acts as a transcriptional regulator by binding to the GJA1/Cx43 promoter and enhancing its up-regulation by ESR1/ER-alpha and is involved in pre-mRNA splicing. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7918 Product name: Recombinant human INI-1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-110 aa of BC007321 Sequence: MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR Predict reactive species Full Name: PHD finger protein 5A Calculated Molecular Weight: 12 kDa Observed Molecular Weight: 12-14 kDa GenBank Accession Number: BC007321 Gene Symbol: PHF5A Gene ID (NCBI): 84844 RRID: AB_2165365 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7RTV0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.