Proteintech, 15654-1-AP, ST6GALNAC4 Polyclonal antibody

Size: 20ul / 150ul The ST6GALNAC4 (15654-1-AP) by Proteintech is a Polyclonal antibody targeting ST6GALNAC4 in IP, ELISA applications with reactivity to human samples 15654-1-AP targets ST6GALNAC4 in IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive IP detected in: HeLa cells Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3-N-acetyl-galactosaminide alpha-2,6-sialyltransferase (also known as ST6GALNAC4) is a member of the sialyltransferases, which catalyzes the transfer of sialic acid from cytidine monosphosphate (CMP)-sialic acid to galactose-containing substrates. ST6GALNAC4 may be induced abnormal TGFBR2 glycosylation, resulting in the higher protein levels of TGFBR2 and TGF pathway increased activation (PMID: 37381011, 37034303). ST6GALNAC4 was reported to influence patient prognosis though subverting immunosurveillance in Chronic lymphocytic leukemia. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7995 Product name: Recombinant human ST6GALNAC4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-302 aa of BC036705 Sequence: MKAPGRLVLIILCSVVFSAVYILLCCWAGLPLCLATCLDHHFPTGSRPTVPGPLHFSGYSSVPDGKPLVREPCRSCAVVSSSGQMLGSGLGAEIDSAECVFRMNQAPTVGFEADVGQRSTLRVVSHTSVPLLLRNYSHYFQKARDTLYMVWGQGRHMDRVLGGRTYRTLLQLTRMYPGLQVYTFTERMMAYCDQIFQDETGKNRRQSGSFLSTGWFTMILALELCEEIVVYGMVSDSYCREKSHPSVPYHYFEKGRLDECQMYLAHEQAPRSAHRFITEKAVFSRWAKKRPIVFAHPSWRTE Predict reactive species Full Name: ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 4 Calculated Molecular Weight: 34 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC036705 Gene Symbol: ST6GALNAC4 Gene ID (NCBI): 27090 RRID: AB_3669218 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H4F1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.