Proteintech, 15849-1-AP, NDUFS4 Polyclonal antibody

Size: 20ul / 150ul The NDUFS4 (15849-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFS4 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15849-1-AP targets NDUFS4 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, rat heart tissue Positive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:100-1:400 Background Information NDUFS4 (NADH dehydrogenase [ubiquinone] iron-sulfur protein 4 mitochondrial), also known as AQDQ, is a member of NADH dehydrogenase (ubiquinone) iron-sulfur (NDUFS) protein family. It is a peripheral membrane protein located on the matrix side of the inner mitochondrial membrane. It is reported that the loss of NDUFS4 protein expression in immunohistochemistry (IHC) reliably diagnoses papillary thyroid carcinoma(PMID: 34792302). Also, NDUFS4 promotes tumor progression and predicts prognosis in gastric cancer(PMID: 36044738). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8633 Product name: Recombinant human NDUFS4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-175 aa of BC005270 Sequence: MAAVSMSVVLRQTLWRRRAVAVAALSVSRVPTRSLRTSSWRLAQDQTQDTQLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK Predict reactive species Full Name: NADH dehydrogenase (ubiquinone) Fe-S protein 4, 18kDa (NADH-coenzyme Q reductase) Calculated Molecular Weight: 175 aa, 20 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC005270 Gene Symbol: NDUFS4 Gene ID (NCBI): 4724 RRID: AB_2878191 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43181 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.