Proteintech, 15965-1-AP, BHMT Polyclonal antibody

Size: 20ul / 150ul The BHMT (15965-1-AP) by Proteintech is a Polyclonal antibody targeting BHMT in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 15965-1-AP targets BHMT in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse kidney tissue, human kidney tissue, L02 cells Positive IP detected in: mouse kidney tissue Positive IHC detected in: human spleen tissue, human heart tissue, human lung tissue, human ovary tissue, human placenta tissue, human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Betaine-homocysteine methyltransferase (BHMT) is a cytosolic enzyme that Involved in the regulation of homocysteine metabolism. BHMT catalyzes the conversion of betaine and homocysteine to dimethylglycine and methionine, respectively. This reaction is also required for the irreversible oxidation of choline(PMID: 8798461, 10529246). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, pig, chicken, goat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8738 Product name: Recombinant human BHMT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-406 aa of BC012616 Sequence: MPPVGGKKAKKGILERLNAGEIVIGDGGFVFALEKRGYVKAGPWTPEAAVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQEVNEAACDIARQVADEGDALVAGGVSQTPSYLSCKSETEVKKVFLQQLEVFMKKNVDFLIAEYFEHVEEAVWAVETLIASGKPVAATMCIGPEGDLHGVPPGECAVRLVKAGASIIGVNCHFDPTISLKTVKLMKEGLEAARLKAHLMSQPLAYHTPDCNKQGFIDLPEFPFGLEPRVATRWDIQKYAREAYNLGVRYIGGCCGFEPYHIRAIAEELAPERGFLPPASEKHGSWGSGLDMHTKPWVRARARKEYWENLRIASGRPYNPSMSKPDGWGVTKGTAELMQQKEATTEQQLKELFEKQKFKSQ Predict reactive species Full Name: betaine-homocysteine methyltransferase Calculated Molecular Weight: 406 aa, 45 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC012616 Gene Symbol: BHMT Gene ID (NCBI): 635 RRID: AB_2290472 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q93088 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.