Proteintech, 16029-1-AP, ERGIC3 Polyclonal antibody

Size: 20ul / 150ul The ERGIC3 (16029-1-AP) by Proteintech is a Polyclonal antibody targeting ERGIC3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 16029-1-AP targets ERGIC3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, K-562 cells, MCF-7 cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information ERGIC3 (Endoplasmic reticulum-Golgi intermediate compartment protein 3 ) is located in the cis face of the Golgi apparatus and vesicular tubular structures between the transitional endoplasmic reticulum (ER) and cis-Golgi. ERGIC3 significantly affects cell growth and causes ER stress-induced cell death, and is involved in the invasion and metastasis in hepatocellular carcinomas (HCC). (PMID: 26177443, PMID: 31142615) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8893 Product name: Recombinant human ERGIC3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 44-383 aa of BC009765 Sequence: SELQYYLTTEVHPELYVDKSRGDKLKINIDVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGIPVSSEAERHELGKVEVTVFDPDSLDPDRCESCYGAEAEDIKCCNTCEDVREAYRRRGWAFKNPDTIEQCRREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVHVHDLQSFGLDNINMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQKKIDLGKTT Predict reactive species Full Name: ERGIC and golgi 3 Calculated Molecular Weight: 383 aa, 43 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC009765 Gene Symbol: ERGIC3 Gene ID (NCBI): 51614 RRID: AB_2098446 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y282 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.