Proteintech, 16039-1-AP, TUSC3 Polyclonal antibody

Size: 20ul / 150ul The TUSC3 (16039-1-AP) by Proteintech is a Polyclonal antibody targeting TUSC3 in WB, ELISA applications with reactivity to human, mouse, rat samples 16039-1-AP targets TUSC3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, rat testis tissue, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information TUSC3 (tumor suppressor candidate 3), originally named N33, is a potential tumor supressor gene. Decreased expression of TUSC3 has been found in various cancers, including prostate cancer, pancreas cancer and ovary cancer. TUSC3 also known as OST3A, is identified as a part of the oligosaccharyl-transferase (OST) complex and plays a crucial role in protein N-glycosylation. TUSC3 mutations have been found in families with non-syndromic autosomal recessive mental retardation. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8912 Product name: Recombinant human TUSC3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 45-199 aa of BC010370 Sequence: KENLLAEKVEQLMEWSSRRSIFRMNGDKFRKFIKAPPRNYSMIVMFTALQPQRQCSVCRQANEEYQILANSWRYSSAFCNKLFFSMVDYDEGTDVFQQLNMNSAPTFMHFPPKGRPKRADTFDLQRIGFAAEQLAKWIADRTDVHIRVFRPPNYS Predict reactive species Full Name: tumor suppressor candidate 3 Calculated Molecular Weight: 347 aa, 40 kDa Observed Molecular Weight: 35-40 kDa GenBank Accession Number: BC010370 Gene Symbol: TUSC3 Gene ID (NCBI): 7991 RRID: AB_2878208 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13454 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.