Proteintech, 16055-1-AP, LYPLA1 Polyclonal antibody

Size: 20ul / 150ul The LYPLA1 (16055-1-AP) by Proteintech is a Polyclonal antibody targeting LYPLA1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 16055-1-AP targets LYPLA1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse brain tissue, human brain tissue, human liver tissue, rat liver tissue, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information LYPLA1(Lysophospholipase 1) is also named as APT1(Acyl-protein thioesterase 1), LPL1 and belongs to the AB hydrolase 2 family. It is an important enzyme responsible for depalmitoylation of palmitoyl proteins and works as a thioesterase that cleaves the S-palmitoyl group of H-Ras, heterotrimeric G protein alfa subunit (Ga) , regulator of G protein signaling 4 (RGS4) and the endothelial isoform of nitric oxide synthase (eNOS) in vitro(PMID:19439193). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9022 Product name: Recombinant human LYPLA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-230 aa of BC010397 Sequence: MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPID Predict reactive species Full Name: lysophospholipase I Calculated Molecular Weight: 230 aa, 25 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC010397 Gene Symbol: LYPLA1 Gene ID (NCBI): 10434 RRID: AB_2234851 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75608 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.