Proteintech, 16241-1-AP, MRPL13 Polyclonal antibody

Size: 20ul / 150ul The MRPL13 (16241-1-AP) by Proteintech is a Polyclonal antibody targeting MRPL13 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat, monkey samples 16241-1-AP targets MRPL13 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat, monkey samples. Tested Applications Positive WB detected in: HL-60 cells, HeLa cells, mouse lung tissue, Jurkat cells, COS-7 cells, rat lung tissue Positive IP detected in: mouse lung tissue Positive IHC detected in: human liver cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information MRPL13, also named as 39S ribosomal protein L13, mitochondrial or L13mt, is a 178 amino acid protein, which belongs to the ribosomal protein L13P family. MRPL13 localizes in the mitochondrion and interacts with OXA1L. MRPL13 is involved in mitochondrial proteins biosynthesis, ribosomal structure and biogenesis. Specification Tested Reactivity: human, mouse, rat, monkey Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9105 Product name: Recombinant human MRPL13 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-178 aa of BC009190 Sequence: MSSFSRAPQQWATFARIWYLLDGKMQPPGKLAAMASIRLQGLHKPVYHALSDCGDHVVIMNTRHIAFSGNKWEQKVYSSHTGYPGGFRQVTAAQLHLRDPVAIVKLAIYGMLPKNLHRRTMMERLHLFPDEYIPEDILKNLVEELPQPRKIPKRLDEYTQEEIDAFPRLWTPPEDYRL Predict reactive species Full Name: mitochondrial ribosomal protein L13 Calculated Molecular Weight: 178 aa, 21 kDa Observed Molecular Weight: 20-23 kDa GenBank Accession Number: BC009190 Gene Symbol: MRPL13 Gene ID (NCBI): 28998 RRID: AB_2145705 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BYD1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.