Proteintech, 16345-1-AP, PSF3 Polyclonal antibody

Size: 20ul / 150ul The PSF3 (16345-1-AP) by Proteintech is a Polyclonal antibody targeting PSF3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 16345-1-AP targets PSF3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF7 cells, HeLa cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9534 Product name: Recombinant human GINS3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-216 aa of BC014437 Sequence: MSEAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETAMPRLGAFFLERSAGAETDNAVPQGSKLELPLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLLQTFIGRFRRIMDSSQNAYNEDTSALVARLDEMERGLFQTGQKGLNDFQCWEKGQASQITASNLVQNYKKRKFTDMED Predict reactive species Full Name: GINS complex subunit 3 (Psf3 homolog) Calculated Molecular Weight: 216 aa, 25 kDa Observed Molecular Weight: 25-30 kDa GenBank Accession Number: BC014437 Gene Symbol: GINS3 Gene ID (NCBI): 64785 RRID: AB_10804660 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BRX5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.