Iright
BRAND / VENDOR: Proteintech

Proteintech, 16346-1-AP, AGER/RAGE Polyclonal antibody

CATALOG NUMBER: 16346-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The AGER/RAGE (16346-1-AP) by Proteintech is a Polyclonal antibody targeting AGER/RAGE in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 16346-1-AP targets AGER/RAGE in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse lung tissue, rat lung tissue Positive IHC detected in: mouse lung tissue, human lung tissue, human renal cell carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse lung tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Advanced glycosylation end product-specific receptor (AGER, also known as RAGE) is a member of the immunoglobulin superfamily of cell surface receptors, which interacts with distinct families of ligands, mediating diverse functions in a broad array of cell types including cellular migration, proliferation, survival and apoptosis (PMID: 12645002; 17425919). It senses endogenous stress signals with a broad ligand repertoire including advanced glycation end products, S100 proteins, high-mobility group box 1 protein/HMGB1, amyloid beta/APP oligomers, nucleic acids, phospholipids and glycosaminoglycans (PMID: 19910580; 28627626). It interacts with distinct molecules implicated in homeostasis, development, inflammation, and certain diseases such as diabetes and Alzheimer's disease (PMID: 26253613; 31079281). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9540 Product name: Recombinant human AGER protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 26-340 aa of BC020669 Sequence: ITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGT Predict reactive species Full Name: advanced glycosylation end product-specific receptor Calculated Molecular Weight: 404 aa, 43 kDa Observed Molecular Weight: 43 kDa GenBank Accession Number: BC020669 Gene Symbol: AGER Gene ID (NCBI): 177 RRID: AB_2878246 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15109 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924