Proteintech, 16364-1-AP, VAV1 Polyclonal antibody

Size: 20ul / 150ul The VAV1 (16364-1-AP) by Proteintech is a Polyclonal antibody targeting VAV1 in WB, IHC, IP, ELISA applications with reactivity to human samples 16364-1-AP targets VAV1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, HL-60 cells, Ramos cells, Raji cells, K-562 cells Positive IP detected in: K-562 cells Positive IHC detected in: human breast cancer tissue, human brain tissue, human heart tissue, human kidney tissue, human liver tissue, human lung tissue, human lymphoma tissue, human spleen tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information Vav proteins mainly act as enzymes that catalyze the activation step of Rho subfamily GTPases during cell signaling. There are three family members:VAV1, VAV2 and VAV3. Vav1 is specifically expressed in the hematopoietic system, whereas Vav2 and Vav3 are more ubiquitously expressed (PMID:14607270). Vav1 is physiologically active as a GDP/GTP nucleotide exchange factor (GEF) in the hematopoietic system (PMID:31654719). Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat, gecko Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9049 Product name: Recombinant human VAV1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 442-790 aa of BC013361 Sequence: EQFEMAISNIYPENATANGHDFQMFSFEETTSCKACQMLLRGTFYQGYRCHRCRASAHKECLGRVPPCGRHGQDFPGTMKKDKLHRRAQDKKRNELGLPKMEVFQEYYGLPPPPGAIGPFLRLNPGDIVELTKAEAEQNWWEGRNTSTNEIGWFPCNRVKPYVHGPPQDLSVHLWYAGPMERAGAESILANRSDGTFLVRQRVKDAAEFAISIKYNVEVKHIKIMTAEGLYRITEKKAFRGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRTISRPAVGSTKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEEDYSEYC Predict reactive species Full Name: vav 1 guanine nucleotide exchange factor Calculated Molecular Weight: 845 aa, 98 kDa Observed Molecular Weight: 98 kDa GenBank Accession Number: BC013361 Gene Symbol: VAV1 Gene ID (NCBI): 7409 RRID: AB_2213571 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P15498 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.