Proteintech, 16483-1-AP, ATP5I Polyclonal antibody

Size: 20ul / 150ul The ATP5I (16483-1-AP) by Proteintech is a Polyclonal antibody targeting ATP5I in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 16483-1-AP targets ATP5I in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, mouse liver tissue Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information ATP5I(ATP synthase subunit e) is also named as ATP5K and belongs to the ATPase e subunit family. The ATP5I gene encodes the e subunit of the mitochondrial ATP synthase Fo complex. Mitochondrial membrane ATP synthase(F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. Antisense ATP5I in a human HCC cell line inhibited cell growth suggesting that ATP5I acts through the MAP kinase pathway(PMID:11939412). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9605 Product name: Recombinant human ATP5I protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-69 aa of BC003679 Sequence: MVPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARELAEDDSILK Predict reactive species Full Name: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit E Calculated Molecular Weight: 69 aa, 8 kDa Observed Molecular Weight: 8 kDa GenBank Accession Number: BC003679 Gene Symbol: ATP5I Gene ID (NCBI): 521 RRID: AB_2062052 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P56385 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.