Proteintech, 16594-1-AP, SDS Polyclonal antibody

Size: 20ul / 150ul The SDS (16594-1-AP) by Proteintech is a Polyclonal antibody targeting SDS in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 16594-1-AP targets SDS in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, mouse brain tissue, rat brain tissue, rat liver tissue Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information L-Serine dehydratase (SDS ; SDH) catalyzes the pyridoxal phosphate (PLP) dependent deamination of l-serine to yield pyruvate. In mammals, SDH is found predominantly in the liver. Extensive studies have been carried out on SDH from rat and the enzyme has been found to play an important role in gluconeogenesis; its activity is induced by the consumption of high-protein diets, starvation and other treatments. The enzyme exists as a dimer of identical subunits, with each subunit exhibiting a bilobal architecture. (PMID: 25380533, PMID: 21878319, PMID: 14646100) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9704 Product name: Recombinant human SDS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-218 aa of BC020750 Sequence: MMSGEPLHVKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHFVCSSAGNAGMAAAYAARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKETLWEKPGAIALSVGGGGLLCGVVQGLQEVGWGDVPVIAMETFGAHSFHAATTAGKLVSLPKITR Predict reactive species Full Name: serine dehydratase Calculated Molecular Weight: 218 aa, 23 kDa Observed Molecular Weight: 35 kDa; 70 kDa GenBank Accession Number: BC020750 Gene Symbol: SDS Gene ID (NCBI): 10993 RRID: AB_3085498 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P20132 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.