Iright
BRAND / VENDOR: Proteintech

Proteintech, 16626-1-AP, EPYC Polyclonal antibody

CATALOG NUMBER: 16626-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EPYC (16626-1-AP) by Proteintech is a Polyclonal antibody targeting EPYC in WB, ELISA applications with reactivity to human, mouse, rat samples 16626-1-AP targets EPYC in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: L02 cells, human testis tissue, mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information EPYC (Epiphycan), also known as DSPG3. It is demonstrated that DSPG3 is expressed in cartilage, as well as ligament and placental tissues (PMID: 8975717). May have a role in bone formation and also in establishing the ordered structure of cartilage through matrix organization. The molecular weight of EPYC is 37 kDa, it is also reported the molecular weight is 62 kDa (PMID: 38184732). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9929 Product name: Recombinant human EPYC protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 24-322 aa of BC030958 Sequence: ESINYDSETYDATLEDLDNLYNYENIPVGKVEIEIATVMPSGNRELLTPPPQPEKAQEEEEEEESTPRLIDGSSPQEPEFTGVLGPHTNEDFPTCLLCTCISTTVYCDDHELDAIPPLPKNTAYFYSRFNRIKKINKNDFASLSDLKRIDLTSNLISEIDEDAFRKLPQLRELVLRDNKIRQLPELPTTLTFIDISNNRLGRKGIKQEAFKDMYDLHHLYLTDNNLDHIPLPLPENLRALHLQNNNILEMHEDTFCNVKNLTYIRKALEDIRLDGNPINLSKTPQAYMCLPRLPVGSLV Predict reactive species Full Name: epiphycan Calculated Molecular Weight: 322 aa, 37 kDa Observed Molecular Weight: 37kDa, 62 kDa GenBank Accession Number: BC030958 Gene Symbol: EPYC Gene ID (NCBI): 1833 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99645 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924