Proteintech, 16654-1-AP, COQ4 Polyclonal antibody

Size: 20ul / 150ul The COQ4 (16654-1-AP) by Proteintech is a Polyclonal antibody targeting COQ4 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 16654-1-AP targets COQ4 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, Transfected HEK-293 cells Positive IP detected in: mouse liver tissue Positive IHC detected in: human liver tissue, human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Human coenzyme Q4 (COQ4), as a component of the coenzyme Q biosynthetic pathway, is required for the oxidative decarboxylation of the C1 carbon of Coenzyme Q in eukaryotic cells (PMID: 38295803). COQ4 deficiency manifests as an early-onset neurodegenerative disorder. COQ4 encodes a ubiquitously expressed 265-amino-acid protein that is peripherally associated with the mitochondrial inner membrane on the matrix side (PMID: 25658047, 34656997) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10089 Product name: Recombinant human COQ4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-265 aa of BC011895 Sequence: MATLLRPVLRRLCGLPGLQRPAAEMPLRARSDGAGPLYSHHLPTSPLQKALLAAGSAAMALYNPYRHDMVAVLGETTGHRTLKVLRDQMRRDPEGAQILQERPRISTSTLDLGKLQSLPEGSLGREYLRFLDVNRVSPDTRAPTRFVDDEELAYVIQRYREVHDMLHTLLGMPTNILGEIVVKWFEAVQTGLPMCILGAFFGPIRLGAQSLQVLVSELIPWAVQNGRRAPCVLNLYYERRWEQSLRALREELGITAPPMHVQGLA Predict reactive species Full Name: coenzyme Q4 homolog (S. cerevisiae) Calculated Molecular Weight: 265 aa, 30 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC011895 Gene Symbol: COQ4 Gene ID (NCBI): 51117 RRID: AB_2878296 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y3A0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.