Proteintech, 16666-1-AP, GTDC1 Polyclonal antibody

Size: 20ul / 150ul The GTDC1 (16666-1-AP) by Proteintech is a Polyclonal antibody targeting GTDC1 in IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 16666-1-AP targets GTDC1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: human liver tissue, human kidney tissue, human ovary tissue, human spleen tissue, human testis tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information GTDC1 (glycosyltransferase-like domain containing 1) encodes a putative glycosyltransferase, whose expression is particularly enriched in the nervous system. GTDC1 glycosylation finely tunes a myriad of neural functions, such as neurite outgrowth, axon guidance, synaptogenesis, membrane excitability, neurotransmission, and neuroinflammation (PMID: 38605125). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10145 Product name: Recombinant human GTDC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-292 aa of BC061699 Sequence: MSILIIEAFYGGSHKQLVDLLQEELGDCVVYTLPAKKWHWRARTSALYFSQTIPISEHYRTLFASSVLNLTELAALRPDLGKLKKILYFHENQLIYPVKKCQERDFQYGYNQILSCLVADVVVFNSVFNMESFLTSMGKFMKLIPDHRPKDLESIIRPKCQVIYFPIRFPDVSRFMPKHKTTHLKKMLGLKGNGGAVLSMALPFQPEQRDSEDLLKNFNSECDTHCGLDTARQEYLGNSLRQESDLKKSTSSDNSSSHHGENKQNLTVDPCDILGGVDNQQRLLHIVWPHRW Predict reactive species Full Name: glycosyltransferase-like domain containing 1 Calculated Molecular Weight: 292 aa, 34 kDa, 53 kDa GenBank Accession Number: BC061699 Gene Symbol: GTDC1 Gene ID (NCBI): 79712 RRID: AB_1851177 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q4AE62 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.