Proteintech, 16684-1-AP, DCTPP1 Polyclonal antibody

Size: 20ul / 150ul The DCTPP1 (16684-1-AP) by Proteintech is a Polyclonal antibody targeting DCTPP1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 16684-1-AP targets DCTPP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse heart tissue, Transfected HEK-293 cells Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information DCTPP1, also named as XTP3TPA, CDAO3 and RS21C6, is a hydrolyzes deoxynucleoside triphosphates (dNTPs) to the corresponding nucleoside monophosphates. It has a central role in the balance of dCTP and the metabolism of deoxycytidine analogues, thus contributing to the preservation of genome integrity. DCTPP1 has some forms such as monomer (~20 kDa), Dimer (~40 kDa) and Homotetramer (~80 kDa). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10015 Product name: Recombinant human DCTPP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-170 aa of BC001344 Sequence: MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKTDGEPGPQGWSPRERAALQEELSDVLIYLVALAARCRVDLPLAVLSKMDINRRRYPAHLARSSSRKYTELPHGAISEDQAVGPADIPCDSTGQTST Predict reactive species Full Name: dCTP pyrophosphatase 1 Calculated Molecular Weight: 19 kDa Observed Molecular Weight: 19 kDa, 40 kDa, 80 kDa GenBank Accession Number: BC001344 Gene Symbol: DCTPP1 Gene ID (NCBI): 79077 RRID: AB_2878299 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H773 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.