Proteintech, 16807-1-AP, SNRPB Polyclonal antibody

Size: 20ul / 150ul The SNRPB (16807-1-AP) by Proteintech is a Polyclonal antibody targeting SNRPB in WB, IHC, ELISA applications with reactivity to human samples 16807-1-AP targets SNRPB in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, K-562 cells Positive IHC detected in: human cervical cancer tissue, human liver cancer tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SNRPB (Small Nuclear Ribonucleoprotein Polypeptides B and B1) is a core component of the spliceosome, a complex molecular machine that plays a critical role in pre-mRNA splicing. This process is essential for the removal of introns and the joining of exons to produce mature mRNA molecules. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10298 Product name: Recombinant human SNRPB protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-234 aa of BC003530 Sequence: MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGKCLQW Predict reactive species Full Name: small nuclear ribonucleoprotein polypeptides B and B1 Calculated Molecular Weight: 234aa,25 kDa; 285aa,30 kDa Observed Molecular Weight: 25-30 kDa GenBank Accession Number: BC003530 Gene Symbol: SNRPB Gene ID (NCBI): 6628 RRID: AB_2878319 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P14678 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.