Proteintech, 16834-1-AP, DOCK10 Polyclonal antibody

Size: 20ul / 150ul The DOCK10 (16834-1-AP) by Proteintech is a Polyclonal antibody targeting DOCK10 in IP, ELISA applications with reactivity to human samples 16834-1-AP targets DOCK10 in IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive IP detected in: HeLa cells Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information DOCK10 (Dedicator of Cytokinesis 10) is a protein-coding gene that belongs to the DOCK family of guanine nucleotide exchange factors (GEFs). It is involved in regulating the activity of Rho GTPases, particularly Rac1 and Cdc42, which play crucial roles in various cellular processes. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10486 Product name: Recombinant human DOCK10 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 194-542 aa of BC015018 Sequence: AVFEKQRDFKKLSDLYYDIHRSYLKVAEVVNSEKRLFGRYYRVAFYGQGFFEEEEGKEYIYKEPKLTGLSEISQRLLKLYADKFGADNVKIIQDSNKVNPKDLDPKYAYIQVTYVTPFFEEKEIEDRKTDFEMHHNINRFVFETPFTLSGKKHGGVAEQCKRRTILTTSHLFPYVKKRIQVISQSSTELNPIEVAIDEMSKKVSELNQLCTMEEVDMIRLQLKLQGSVSVKVNAGPMAYARAFLEETNAKKYPDNQVKLLKEIFRQFADACGQALDVNERLIKEDQLEYQEELRSHYKDMLSELSTVMNEQITGRDDLSKRGVDQTCTRVISKATPALPTVSISSSAEV Predict reactive species Full Name: dedicator of cytokinesis 10 Calculated Molecular Weight: 542 aa, 62 kDa Observed Molecular Weight: 250 kDa GenBank Accession Number: BC015018 Gene Symbol: DOCK10 Gene ID (NCBI): 55619 RRID: AB_2878323 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96BY6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.