Proteintech, 16835-1-AP, Cytokeratin 80 Polyclonal antibody

Size: 20ul / 150ul The Cytokeratin 80 (16835-1-AP) by Proteintech is a Polyclonal antibody targeting Cytokeratin 80 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 16835-1-AP targets Cytokeratin 80 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: NIH/3T3 cells, human skeletal muscle tissue Positive IHC detected in: human skin cancer tissue, human bowen disease, human colon cancer, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3600 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information KRT80 is a human IF type II epithelial keratin gene involved in the formation of IF heterodimers in various epithelial cells. KRT80 is overexpressed in many neoplasms and plays an essential role in promoting cell proliferation, migration and invasiveness, and is associated with poor prognosis in cancer patients. KRT80 has three isoforms with predicted MW of 50 kDa, 47 kDa, and 54 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10498 Product name: Recombinant human KRT80 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-422 aa of BC065180 Sequence: MACRSCVVGFSSLSSCEVTPVGSPRPGTSGWDSCRAPGPGFSSRSLTGCWSAGTISKVTVNPGLLVPLDVKLDPAVQQLKNQEKEEMKALNDKFASLIGKVQALEQRNQLLETRWSFLQGQDSAIFDLGHLYEEYQGRLQEELRKVSQERGQLEANLLQVLEKVEEFRIRYEDEISKRTDMEFTFVQLKKDLDAECLHRTELETKLKSLESFVELMKTIYEQELKDLAAQVKDVSVTVGMDSRCHIDLSGIVEEVKAQYDAVAARSLEEAEAYSRSQLEEQAARSAEYGSSLQSSRSEIADLNVRIQKLRSQILSVKSHCLKLEENIKTAEEQGELAFQDAKTKLAQLEAALQQAKQDMARQLRKYQELMNVKLALDIEIATYRKLVEGEEGRMDSPSATVVSAVQSRCKTAPSLPYPLCSL Predict reactive species Full Name: keratin 80 Calculated Molecular Weight: 422 aa, 47 kDa Observed Molecular Weight: 47 kDa, 50 kDa GenBank Accession Number: BC065180 Gene Symbol: KRT80 Gene ID (NCBI): 144501 RRID: AB_1851273 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6KB66 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.