Proteintech, 16846-1-AP, GPX8 Polyclonal antibody

Size: 20ul / 150ul The GPX8 (16846-1-AP) by Proteintech is a Polyclonal antibody targeting GPX8 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 16846-1-AP targets GPX8 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: U-251 cells, HEK-293 cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GPX8(Probable glutathione peroxidase 8) is also named as GSHPx-8 and belongs to the glutathione peroxidase family. Glutathione peroxidase (GPx) reduces hydroperoxides, including hydrogen peroxides, in the presence of reduced glutathione as a means of protecting organisms from oxidative damage. Several GPx isozymes have been identified in animal cells and these have been classified into different groups according to their cellular location and substrate specificity. In humans, eight types of GPx have been identified from GPx1 to GPx8. The full length GPX8 has 209 amino acids and the molecular weight is 24 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9930 Product name: Recombinant human GPX8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 38-209 aa of BC029424 Sequence: KFLKPKINSFYAFEVKDAKGRTVSLEKYKGKVSLVVNVASDCQLTDRNYLGLKELHKEFGPSHFSVLAFPCNQFGESEPRPSKEVESFARKNYGVTFPIFHKIKILGSEGEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKFWRPEEPIEVIRPDIAALVRQVIIKKKEDL Predict reactive species Full Name: glutathione peroxidase 8 (putative) Calculated Molecular Weight: 209 aa, 24 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: BC029424 Gene Symbol: GPX8 Gene ID (NCBI): 493869 RRID: AB_2878325 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TED1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.