Proteintech, 16897-1-AP, GPT / ALT1 Polyclonal antibody

Size: 20ul / 150ul The GPT / ALT1 (16897-1-AP) by Proteintech is a Polyclonal antibody targeting GPT / ALT1 in WB, ELISA applications with reactivity to human, mouse, rat samples 16897-1-AP targets GPT / ALT1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, rat liver tissue, mouse spleen tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information GPT, also known as ALT1 (glutamate-pyruvate transaminase 1), catalyzes the reversible transamination between alanine and 2-oxoglutarate to generate pyruvate and glutamate and, therefore, plays a key role in the intermediary metabolism of glucose and amino acids. Serum activity levels of this enzyme are routinely used as a biomarker of liver injury caused by drug toxicity, infection, alcohol, and steatosis. A related gene on chromosome 16 encodes a putative mitochondrial alanine aminotransaminase. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10424 Product name: Recombinant human GPT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 147-496 aa of BC018207 Sequence: IPADPNNVFLSTGASDAIVTVLKLLVAGEGHTRTGVLIPIPQYPLYSATLAELGAVQVDYYLDEERAWALDVAELHRALGQARDHCRPRALCVINPGNPTGQVQTRECIEAVIRFAFEERLFLLADEVYQDNVYAAGSQFHSFKKVLMEMGPPYAGQQELASFHSTSKGYMGECGFRGGYVEVVNMDAAVQQQMLKLMSVRLCPPVPGQALLDLVVSPPAPTDPSFAQFQAEKQAVLAELAAKAKLTEQVFNEAPGISCNPVQGAMYSFPRVQLPPRAVERAQELGLAPDMFFCLRLLEETGICVVPGSGFGQREGTYHFRMTILPPLEKLRLLLEKLSRFHAKFTLEYS Predict reactive species Full Name: glutamic-pyruvate transaminase (alanine aminotransferase) Calculated Molecular Weight: 496 aa, 55 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC018207 Gene Symbol: ALT1 Gene ID (NCBI): 2875 RRID: AB_2230815 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P24298 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.