Proteintech, 17000-1-AP, CD14 Polyclonal antibody

Size: 20ul / 150ul The CD14 (17000-1-AP) by Proteintech is a Polyclonal antibody targeting CD14 in IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse, pig samples 17000-1-AP targets CD14 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, pig samples. Tested Applications Positive IHC detected in: human tonsillitis tissue, human appendicitis tissue, human hepatocirrhosis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse testis tissue, human tonsillitis tissue Positive IF/ICC detected in: RAW 264.7 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information CD14 is a 50-55 kDa glycosylphosphatidylinositol-anchored glycoprotein preferentially expressed on monocytes and macrophages, and at lower levels on granulocytes (PMID: 3385210; 2462937; 7685797). CD14 can also exist as a soluble protein. CD14 acts as a co-receptor for bacterial liposaccharides (LPS) (PMID: 1698311). It plays a major role in the inflammatory response of monocytes to LPS. Specification Tested Reactivity: human, mouse, pig Cited Reactivity: human, mouse, rat, pig, sheep Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10693 Product name: Recombinant human CD14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-375 aa of BC010507 Sequence: MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA Predict reactive species Full Name: CD14 molecule Calculated Molecular Weight: 375 aa, 40 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC010507 Gene Symbol: CD14 Gene ID (NCBI): 929 ENSEMBL Gene ID: ENSG00000170458 RRID: AB_2074048 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P08571 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.