Proteintech, 17169-1-AP, LOH12CR1 Polyclonal antibody

Size: 20ul / 150ul The LOH12CR1 (17169-1-AP) by Proteintech is a Polyclonal antibody targeting LOH12CR1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 17169-1-AP targets LOH12CR1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, K-562 cells Positive IHC detected in: human lung cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information LOH12CR1, also named as BORCS5, is part of the BORC complex may play a role in lysosomes movement and localization at the cell periphery. It may indirectly play a role in cell spreading and motility. LOH12CR1 has two isoforms with MW 17 kDa and 22 kDa. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10695 Product name: Recombinant human LOH12CR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-196 aa of BC013668 Sequence: MGSEQSSEAESRPNDLNSSVTPSPAKHRAKMDDIVVVAQGSQASRNVSNDPDVIKLQEIPTFQPLLKGLLSGQTSPTNAKLEKLDSQQVLQLCLRYQDHLHQCAEAVAFDQNALVKRIKEMDLSVETLFSFMQERQKRYAKYAEQIQKVNEMSAILRRIQMGIDQTVPLLDRLNSMLPEGERLEPFSMKPDRELRL Predict reactive species Full Name: loss of heterozygosity, 12, chromosomal region 1 Calculated Molecular Weight: 196 aa, 22 kDa Observed Molecular Weight: 17-22 kDa GenBank Accession Number: BC013668 Gene Symbol: LOH12CR1 Gene ID (NCBI): 118426 RRID: AB_2137150 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q969J3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.