Proteintech, 17193-1-AP, RSPO3 Polyclonal antibody

Size: 20ul / 150ul The RSPO3 (17193-1-AP) by Proteintech is a Polyclonal antibody targeting RSPO3 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 17193-1-AP targets RSPO3 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse small intestine tissue, Transfected HEK-293 cells Positive IP detected in: human placenta tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information RSPO3, also named as R-spondin-3, is a 272 amino acid protein, which contains 1 TSP type-1 domain and 2 FU (furin-like) repeats. RSPO3 may be a secreted protein and belongs to the R-spondin family. RSPO3 is expressed at higher level in placenta, small intestine, fetal thymus and lymph node. RSPO3 is an activator of the canonical Wnt signaling pathway by acting as a ligand for LGR4-6 receptors. The four R-spondins (RSPO1-4) and three related leucinerich repeat-containing G-protein coupled receptors, LGR4, LGR5, and LGR6 (LGR4-6), constitute a ligand-receptor system that plays critical roles in development, stem cell survival, and oncogenesis. Ectopic expression of RSPO2/3in mouse mammary epithelial cells led to an increase in invasiveness in vitro and in tumor formation and metastasis in vivo. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9899 Product name: Recombinant human RSPO3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 27-272 aa of BC022367 Sequence: GRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIVHCEVSEWNPWSPCTKKGKTCGFKRGTETRVREIIQHPSAKGNLCPPTNETRKCTVQRKKCQKGERGKKGRERKRKKPNKGESKEAIPDSKSLESSKEIPEQRENKQQQKKRKVQDKQKSVSVSTVH Predict reactive species Full Name: R-spondin 3 homolog (Xenopus laevis) Calculated Molecular Weight: 272 aa, 31 kDa Observed Molecular Weight: 30-40 kDa GenBank Accession Number: BC022367 Gene Symbol: RSPO3 Gene ID (NCBI): 84870 RRID: AB_2878360 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BXY4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.