Iright
BRAND / VENDOR: Proteintech

Proteintech, 17232-1-AP, TLR7 Polyclonal antibody

CATALOG NUMBER: 17232-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TLR7 (17232-1-AP) by Proteintech is a Polyclonal antibody targeting TLR7 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 17232-1-AP targets TLR7 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse lung tissue, Jurkat cells Positive IHC detected in: human lung tissue, human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Among the TLR family, TLR7 (toll-like receptor 7) is an endosomal innate immune sensor that can detect single-stranded ribonucleic acid. Constitutive expression of TLR7 is pre-dominant in dendritic cells and B cells compared to other immune cells. Low levels of TLR7 expression have been observed in non-immune cells, such as hepatocytes, epithelial cells, and keratinocytes (PMID: 37596656). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11073 Product name: Recombinant human TLR7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-348 aa of BC033651 Sequence: LLGARWFPKTLPCDVTLDVPKNHVIVDCTDKHLTEIPGGIPTNTTNLTLTINHIPDISPASFHRLDHLVEIDFRCNCVPIPLGSKNNMCIKRLQIKPRSFSGLTYLKSLYLDGNQLLEIPQGLPPSLQLLSLEANNIFSIRKENLTELANIEILYLGQNCYYRNPCYVSYSIEKDAFLNLTKLKVLSLKDNNVTAVPTVLPSTLTELYLYNNMIAKIQEDDFNNLNQLQILDLSGNCPRCYNAPFPCAPCKNNSPLQIPVNAFDALTELKVLRLHSNSLQHVPPRWFKNINKLQELDLSQNFLAKEIGDAKFLHFLPSLIQLDLS Predict reactive species Full Name: toll-like receptor 7 Calculated Molecular Weight: 1049 aa, 121 kDa Observed Molecular Weight: 121 kDa, 100 kDa GenBank Accession Number: BC033651 Gene Symbol: TLR7 Gene ID (NCBI): 51284 RRID: AB_2203464 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NYK1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924