Proteintech, 17239-1-AP, Complement C6 Polyclonal antibody

Size: 20ul / 150ul The Complement C6 (17239-1-AP) by Proteintech is a Polyclonal antibody targeting Complement C6 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 17239-1-AP targets Complement C6 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human blood Positive IP detected in: human plasma Positive IHC detected in: mouse liver tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The final consequence of complement activation is formation of the membrane attack complex (MAC), a multiprotein assembly that perforates cell membranes, forming transmembrane channels. C6 is 1 of 5 late-acting proteins of complement that participate in assembly and function of the MAC. The deduced C6 protein contains 934 amino acids, including a 21-amino acid N-terminal signal sequence and 2 N-glycosylation sites. Mutations in the C6 gene are associated with complement component-6 deficiency. Specification Tested Reactivity: human, mouse Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11083 Product name: Recombinant human C6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 586-934 aa of BC035723 Sequence: TRECNNPAPQRGGKRCEGEKRQEEDCTFSIMENNGQPCINDDEEMKEVDLPEIEADSGCPQPVPPENGFIRNEKQLYLVGEDVEISCLTGFETVGYQYFRCLPDGTWRQGDVECQRTECIKPVVQEVLTITPFQRLYRIGESIELTCPKGFVVAGPSRYTCQGNSWTPPISNSLTCEKDTLTKLKGHCQLGQKQSGSECICMSPEEDCSHHSEDLCVFDTDSNDYFTSPACKFLAEKCLNNQQLHFLHIGSCQDGRQLEWGLERTRLSSNSTKKESCGYDTCYDWEKCSASTSKCVCLLPPQCFKGGNQLYCVKMGSSTSEKTLNICEVGTIRCANRKMEILHPGKCLA Predict reactive species Full Name: complement component 6 Calculated Molecular Weight: 934 aa, 105 kDa Observed Molecular Weight: 105-120 kDa GenBank Accession Number: BC035723 Gene Symbol: C6 Gene ID (NCBI): 729 RRID: AB_2878366 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P13671 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.