Proteintech, 17268-1-AP, UGT3A1 Polyclonal antibody

Size: 20ul / 150ul The UGT3A1 (17268-1-AP) by Proteintech is a Polyclonal antibody targeting UGT3A1 in WB, ELISA applications with reactivity to human, mouse, rat samples 17268-1-AP targets UGT3A1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse colon tissue, mouse kidney tissue, rat colon tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Background Information UGT3A1 (UDP Glycosyltransferase Family 3 Member A1) belongs to UDP-Glucuronosyltransferases (UGTs) superfamily. UGTs are membrane-bound enzymes localized at the subcellular level in the endoplasmic reticulum (ER) with an active site facing the lumenal side of the ER membrane. The genetic variation in UGT enzymes can modulate its regulation and expression, influencing UGT activity and resulting in pharmacological and physiologic effects. UGT3 family enzymes (UGT3A1 and UGT3A2) are expressed in the thymus, testis, and kidney, with a potential role in the metabolism of ursodeoxycholic acid during the treatment of cholestasis or gallstones. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11020 Product name: Recombinant human UGT3A1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-252 aa of BC035012 Sequence: MLHQSGKFLIPDIKEEEKSYQVIRWFSPEDHQKRIKKHFDSYIETALDGRKESEALVKLMEIFGTQCSYLLSRKDIMDSLKNENYDLVFVEAFDFCSFLIAEKLVKPFVAILPTTFGSLDFGLPSPLSYVPVFPSLLTDHMDFWGRVKNFLMFFSFSRSQWDMQSTFDNTIKEHFPEGSRPVLSHLLLKAELWFVNSDFAFDFARPLLPNTVYIGGLMEKPIKPVPQNGQPALFTTPSLFSSGVYPEPLRRL Predict reactive species Full Name: UDP glycosyltransferase 3 family, polypeptide A1 Calculated Molecular Weight: 59 kDa Observed Molecular Weight: 53 kDa GenBank Accession Number: BC035012 Gene Symbol: UGT3A1 Gene ID (NCBI): 133688 RRID: AB_2304309 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6NUS8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.