Iright
BRAND / VENDOR: Proteintech

Proteintech, 17276-1-AP, EFCAB1 Polyclonal antibody

CATALOG NUMBER: 17276-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EFCAB1 (17276-1-AP) by Proteintech is a Polyclonal antibody targeting EFCAB1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 17276-1-AP targets EFCAB1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Positive IHC detected in: human colon tissue, human liver tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information EFCAB1, also known as Calaxin, is a gene that encodes a protein involved in the function of cilia and flagella, which are hair-like structures protruding from the surface of certain cells. Research indicates that EFCAB1 overexpression inhibits cell proliferation, migration, and invasion while promoting apoptosis in lung adenocarcinoma cells. This suggests that EFCAB1 could potentially serve as a biomarker for lung adenocarcinoma. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11039 Product name: Recombinant human EFCAB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-211 aa of BC025676 Sequence: MNRKKLQKLTDTLTKNCKHFNKFEVNCLIKLFYDLVGGVERQGLVVGLDRNAFRNILHVTFGMTDDMIMDRVFRGFDKDNDGCVNVLEWIHGLSLFLRGSLEEKMKYCFEVFDLNGDGFISKEEMFHMLKNSLLKQPSEEDPDEGIKDLVEITLKKMDHDHDGKLSFADYELAVREETLLLEAFGPCLPDPKSQMEFEAQVFKDPNEFNDM Predict reactive species Full Name: EF-hand calcium binding domain 1 Calculated Molecular Weight: 211 aa, 24 kDa GenBank Accession Number: BC025676 Gene Symbol: EFCAB1 Gene ID (NCBI): 79645 RRID: AB_2878375 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HAE3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924