Proteintech, 17277-1-AP, LARP2 Polyclonal antibody

Size: 20ul / 150ul The LARP2 (17277-1-AP) by Proteintech is a Polyclonal antibody targeting LARP2 in WB, IHC, ELISA applications with reactivity to human, mouse samples 17277-1-AP targets LARP2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, PC-3 cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The La-related proteins (LARPs) share a conserved RNA-binding unit composed of a La Motif and an RNA Recognition Motif (RRM), which recognizes diverse RNA substrates. LARP2 has nine isoforms with MW 30-40 kDa, 90-105 kDa. Alternative splicing has been observed at this locus and multiple variants, encoding distinct isoforms, are described. Additional splice variation has been identified but the full-length nature of these transcripts has not been determined. (PMID: 26501340, PMID: 33292040) Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11043 Product name: Recombinant human LARP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-201 aa of BC030516 Sequence: MDSRDHGPGTSSVSTSNASPSEGAPLAGSYGCTPHSFPKFQHPSHELLKENGFTQQVYHKYRRRCLSERKRLGIGQSQEMNTLFRFWSFFLRDHFNKKMYEEFRQLAWEDAKENYRYGLECLFRFYSYGLEKKFRREIFQDFQEETKKDYESGQLYGLEKFWAYLKYSQSKTQSIDPKLQEYLCSFKRLEDFRVDEADPIE Predict reactive species Full Name: La ribonucleoprotein domain family, member 2 Calculated Molecular Weight: 201 aa, 24 kDa Observed Molecular Weight: 30-40 kDa GenBank Accession Number: BC030516 Gene Symbol: LARP2 Gene ID (NCBI): 55132 RRID: AB_2918052 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q659C4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.