Proteintech, 17280-1-AP, MRPS27 Polyclonal antibody

Size: 20ul / 150ul The MRPS27 (17280-1-AP) by Proteintech is a Polyclonal antibody targeting MRPS27 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 17280-1-AP targets MRPS27 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells Positive IP detected in: A431 cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Genes encoding PPR (pentatricopeptide repeat)-containing proteins constitute one of the largest gene families in plants. The majority of these proteins are predicted to target organelles and to bind to RNA. Strikingly, there is a dearth of these proteins in mammals, although genomic searches reveal six candidates, all of which are also predicted to target the mitochondrion. One of these proteins, MRPS27is participated in transcription and translation respectively. [PMID:18939947] MRPS27is a component of the small subunit of the mitochondrial ribosome that is encoded by the nuclear genome [PMID: 11279123]. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11047 Product name: Recombinant human MRPS27 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-168 aa of BC030521 Sequence: MPLIWKPGYLDRALQVMEKVAASPEDIKLCREALDVLGAVLKALTSADGASEEQSQNDEDNQGSEKLVEQLDIEETEQSKLPQYLERFKALHSKLQALGKIESEGLLSLTTQLVKEKLSTCEAEDIATYEQNLQQWHLDLVQLIQREQQQREQAKQEYQAQKAAKASA Predict reactive species Full Name: mitochondrial ribosomal protein S27 Calculated Molecular Weight: 168 aa, 19 kDa, 48 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: BC030521 Gene Symbol: MRPS27 Gene ID (NCBI): 23107 RRID: AB_2180510 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92552 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.