Iright
BRAND / VENDOR: Proteintech

Proteintech, 17317-1-AP, BAT5 Polyclonal antibody

CATALOG NUMBER: 17317-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The BAT5 (17317-1-AP) by Proteintech is a Polyclonal antibody targeting BAT5 in WB, IHC, ELISA applications with reactivity to human, mouse samples 17317-1-AP targets BAT5 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human placenta tissue, mouse cerebellum tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Human lymphocyte antigen B-associated transcript 5 (BAT5, also known as ABHD16A) is a 558 residue (63 kDa) protein encoded by 20 exons located on chromosome 6p21.33. BAT5 belongs to the α/β-hydrolase domain (ABHD) containing family of metabolic serine hydrolases and possesses both an esterase catalytic triad and an acyltransferase domain (PMID: 25290914). BAT5 not only participates in lipid metabolism but is also involved in the regulation of inflammation and immunity. BAT5 is predicted to be an integral membrane protein with highest mRNA transcript levels in mouse tissues found in testis, heart, muscle, and brain (PMID: 23328280). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11287 Product name: Recombinant human BAT5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 209-558 aa of BC031839 Sequence: SYLVAHTLGRRMLYPGSVYLLQKALMPVLLQGQARLVEECNGRRAKLLACDGNEIDTMFVDRRGTAEPQGQKLVICCEGNAGFYEVGCVSTPLEAGYSVLGWNHPGFAGSTGVPFPQNEANAMDVVVQFAIHRLGFQPQDIIIYAWSIGGFTATWAAMSYPDVSAMILDASFDDLVPLALKVMPDSWRGLVTRTVRQHLNLNNAEQLCRYQGPVLLIRRTKDEIITTTVPEDIMSNRGNDLLLKLLQHRYPRVMAEEGLRVVRQWLEASSQLEEASIYSRWEVEEDWCLSVLRSYQAEHGPDFPWSVGEDMSADGRRQLALFLARKHLHNFEATHCTPLPAQNFQMPWHL Predict reactive species Full Name: HLA-B associated transcript 5 Calculated Molecular Weight: 558 aa, 63 kDa Observed Molecular Weight: 59~63 KdA GenBank Accession Number: BC031839 Gene Symbol: BAT5 Gene ID (NCBI): 7920 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95870 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924