Iright
BRAND / VENDOR: Proteintech

Proteintech, 17342-1-AP, CD11c Polyclonal antibody

CATALOG NUMBER: 17342-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CD11c (17342-1-AP) by Proteintech is a Polyclonal antibody targeting CD11c in WB, IHC, ELISA applications with reactivity to human samples 17342-1-AP targets CD11c in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: THP-1 cells, human plasma Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human tonsillitis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information Integrins are cell adhesion receptors that are heterodimers composed of non-covalently associated α and β subunits. CD11c/Integrin alpha X is a 145-150 kDa type I transmembrane glycoprotein present on a variety of cells, including monocytes/macrophages, granulocytes, NK cells and dendritic cells. Integrin alpha X/beta 2 acts a receptor for fibrinogen and is important in monocyte adhesion and chemotaxis. Specification Tested Reactivity: human Cited Reactivity: human, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11380 Product name: Recombinant human CD11c/Integrin alpha X protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-352 aa of BC038237 Sequence: NLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAANQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQFQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHRLFHASYGARRDAAKILIVITDGKKEGDSLDYKDVIPMADAAGIIRYAIGVGLAFQNRNSWKELNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMA Predict reactive species Full Name: integrin, alpha X (complement component 3 receptor 4 subunit) Calculated Molecular Weight: 1169 aa, 129 kDa Observed Molecular Weight: 140-150 kDa GenBank Accession Number: BC038237 Gene Symbol: CD11c Gene ID (NCBI): 3687 ENSEMBL Gene ID: ENSG00000140678 RRID: AB_2129787 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P20702 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924