Proteintech, 17361-1-AP, LY6D Polyclonal antibody

Size: 20ul / 150ul The LY6D (17361-1-AP) by Proteintech is a Polyclonal antibody targeting LY6D in WB, IHC, ELISA applications with reactivity to human samples 17361-1-AP targets LY6D in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells Positive IHC detected in: human skin cancer tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information LY6D, also named as E48 and ThB, may act as a specification marker at earliest stage specification of lymphocytes between B- and T-cell development. It marks the earliest stage of B-cell specification. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10714 Product name: Recombinant human LY6D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-102 aa of BC031330 Sequence: MRTALLLLATLAVATGPALTLRCHVCTSSSNCKHSVVCPASSRFCKTTNTVEPLRGNLVKKDCAESCTPSYTLQGQVSSGTSSTQCCQEDLCNEKLHNAAPT Predict reactive species Full Name: lymphocyte antigen 6 complex, locus D Calculated Molecular Weight: 128 aa, 13 kDa Observed Molecular Weight: 13-14 kDa GenBank Accession Number: BC031330 Gene Symbol: LY6D Gene ID (NCBI): 8581 RRID: AB_2878397 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14210 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.