Proteintech, 17437-1-AP, SLC25A41 Polyclonal antibody

Size: 20ul / 150ul The SLC25A41 (17437-1-AP) by Proteintech is a Polyclonal antibody targeting SLC25A41 in IHC, ELISA applications with reactivity to human samples 17437-1-AP targets SLC25A41 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Solute carrier family 25 member 41 (SLC25A41), also known as SCaMC-3-like, belongs to the mitochondrial carrier (TC 2.A.29) family. SLC25A41 lacks the Ca2+-binding N-extension. SLC25A41 represents a novel mechanism involved in adenine nucleotide transport across the inner mitochondrial membrane different to ADP/ATP translocases or long SCaMC paralogues (PMID: 18928449). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11508 Product name: Recombinant human SLC25A41 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-251 aa of BC031671 Sequence: MQVYSSKTNFTNLLGGLQSMVQEGGFRSLWRGNGINVLKIAPEYAIKFSVFEQCKNYFCGIQGSPPFQERLLAGSLAVAISQTLINPMEVLKTRLTLRRTGQYKGLLDCARQILQREGTRALYRGYLPNMLGIIPYACTDLAVYEMLQCFWVKSGRDMGDPSGLVSLSSVTLSTTCGQMASYPLTLVRTRMQAQDTVEGSNPTMRGVLQRILAQQGWLGLYRGMTPTLLKVLPAGGISYVVYEAMKKTLGI Predict reactive species Full Name: solute carrier family 25, member 41 Calculated Molecular Weight: 251 aa, 28 kDa GenBank Accession Number: BC031671 Gene Symbol: SLC25A41 Gene ID (NCBI): 284427 RRID: AB_3669274 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N5S1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.