Proteintech, 17506-1-AP, TOM1 Polyclonal antibody

Size: 20ul / 150ul The TOM1 (17506-1-AP) by Proteintech is a Polyclonal antibody targeting TOM1 in WB, ELISA applications with reactivity to human, mouse, rat samples 17506-1-AP targets TOM1 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human liver tissue, HeLa cells, human skeletal muscle tissue, K-562 cells, L02 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information TOM1 is a member of VHS (VPS-27, Hrs, and STAM)-domain-containing protein family that functions as adaptor proteins in the intracellular trafficking and sorting of plasma membrane proteins. TOM1 colocalized with key proteins of the protein-degradation systems. Recently TOM1 has been reported to be localized in the hallmarks of AD pathology (27206884). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11706 Product name: Recombinant human TOM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 140-493 aa of BC046151 Sequence: IYEDLRRKGLEFPMTDLDMLSPIHTPQRTVFNSETQSGQDSVGTDSSQQEDSGQHAAPLPAPPILSGDTPIAPTPEQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHERFERFRTGQTTKAPSEAEPAADLIDMGPDPAATGNLSSQLAGMNLGSSSVRAGLQSLEASGRLEDEFDMFALTRGSSLADQRKEVKYEAPQATDGLAGALDARQQSTGAIPVTQACLMEDIEQWLSTDVGNDAEEPKGVTSEGKFDKFLEERAKAADRLPNLSSPSAEGPPGPPSGPAPRKKTQEKDDDMLFAL Predict reactive species Full Name: target of myb1 (chicken) Calculated Molecular Weight: 493 aa, 54 kDa Observed Molecular Weight: 54 kDa GenBank Accession Number: BC046151 Gene Symbol: TOM1 Gene ID (NCBI): 10043 RRID: AB_2207412 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60784 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.