Proteintech, 17697-1-AP, MAN2B2 Polyclonal antibody

Size: 20ul / 150ul The MAN2B2 (17697-1-AP) by Proteintech is a Polyclonal antibody targeting MAN2B2 in WB, ELISA applications with reactivity to human, mouse, rat samples 17697-1-AP targets MAN2B2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, mouse lung tissue, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11952 Product name: Recombinant human MAN2B2 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 660-1009 aa of BC033307 Sequence: VTEIRQYFYRNMTAQNYTYAIRSRLTHVPQGHDGELLCHRIEQEYQAGPLELNREAVLRTSTNLNSQQVIYSDNNGYQMQRRPYVSYVNNSIARNYYPMVQSAFMEDGKSRLVLLSERAHGISSQGNGQVEVMLHRRLWNNFDWDLGYNLTLNDTSVVHPVLWLLLGSWSLTTALRQRSALALQHRPVVLFGDLAGTAPKLPGPQQQEAVTLPPNLHLQILSIPGWRYSSNHTEHSQNLRKGHRGEAQADLRRVLLRLYHLYEVGEDPVLSQPVTVNLEAVLQALGSVVAVEERSLTGTWDLSMLHRWSWRTGPGRHRGDTTSPSRPPGGPIITVHPKEIRTFFIHFQQQ Predict reactive species Full Name: mannosidase, alpha, class 2B, member 2 Calculated Molecular Weight: 1009 aa, 114 kDa Observed Molecular Weight: 135 kDa GenBank Accession Number: BC033307 Gene Symbol: MAN2B2 Gene ID (NCBI): 23324 RRID: AB_2139566 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y2E5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.