Proteintech, 17721-1-AP, DHX9 Polyclonal antibody

Size: 20ul / 150ul The DHX9 (17721-1-AP) by Proteintech is a Polyclonal antibody targeting DHX9 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 17721-1-AP targets DHX9 in WB, IHC, IF/ICC, IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse testis tissue, rat spleen tissue, rat testis tissue, Jurkat cells Positive IHC detected in: mouse brain tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information RNA helicases play important roles in transcription, RNA processing, translation, and RNA replication. DEAD box proteins are putative RNA helicases that have a characteristic Asp-Glu-Ala-Asp (DEAD) box as 1 of 8 highly conserved sequence motifs. DHX9 a member of the DEAH family of proteins, which possess a double-stranded RNA-binding domain (dsRBD) and a helicase domain [PMID:20569003]. It unwinds double-stranded DNA and RNA in a 3' to 5' direction. Alteration of secondary structure of DHX9 may subsequently influence interactions with proteins or other nucleic acids. It is also a component of the CRD-mediated complex that promotes MYC mRNA stability. In addition, it is involved with LARP6 in the stabilization of type I collagen mRNAs for CO1A1 and CO1A2[PMID: 19029303, 22190748]. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, bovine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12104 Product name: Recombinant human DHX9 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-300 aa of BC014246 Sequence: MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSNAARDFVNYLVRINEIKSEEVPAFGVASPPPLTDTPDTTANAEGDLPTTMGGPLPPHLALKAENNSEVGASGYGVPGPTWDRGANLKDYYSRKEEQEVQATLESEEVDLNAGLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIKQLGRRIFAREHGSNKKLAAQSCALSLVRQLYHLGVVEAYSGLTKKKEGETVEPYKVNLSQDLEHQLQNIIQELNLEILPP Predict reactive species Full Name: DEAH (Asp-Glu-Ala-His) box polypeptide 9 Calculated Molecular Weight: 1270 aa, 141 kDa Observed Molecular Weight: 140 kDa GenBank Accession Number: BC014246 Gene Symbol: DHX9 Gene ID (NCBI): 1660 RRID: AB_2092506 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q08211 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.