Iright
BRAND / VENDOR: Proteintech

Proteintech, 17772-1-AP, NOX1 Polyclonal antibody

CATALOG NUMBER: 17772-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NOX1 (17772-1-AP) by Proteintech is a Polyclonal antibody targeting NOX1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 17772-1-AP targets NOX1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, rat kidney tissue Positive IHC detected in: Human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information NNOX1(NADPH oxidase 1) is also named as MOX1, NOH1 and belongs to the reactive oxygen species (ROS)-generating NADPH oxidase family. It plays a role in host defense, cell growth and differentiation, cell migration, and malignant transformation(PMID:20351171). It also can mediate oncogenic Ras-induced upregulation of VEGF and angiogenesis by activating Sp1 through Ras-ERK-dependent phosphorylation of Sp1(PMID:18454179). It has 3 isoforms produced by alternative splicing with the molecular weight of 65 kDa, 22 kDa and 59 kDa. The full length protein has two glycosylation sites. It always can be detected two bands of 63 kDa and 55 kDa in cells by western blot or another lower band of 45 kDa which is not likely due to alternative translation or splice variation, but as adjustment for the signal peptide and tag removal(PMID:17560373) or unspecifc(PMID:17460729). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12187 Product name: Recombinant human NOX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 292-560 aa of BC075014 Sequence: QQKVVITKVVMHPSKVLELQMNKRGFSMEVGQYIFVNCPSISLLEWHPFTLTSAPEEDFFSIHIRAAGDWTENLIRAFEQQYSPIPRIEVDGPFGTASEDVFQYEVAVLVGAGIGVTPFASILKSIWYKFQCADHNLKTKKIYFYWICRETGAFSWFNNLLTSLEQEMEELGKVGFLNYRLFLTGWDSNIVGHAALNFDKATDIVTGLKQKTSFGRPMWDNEFSTIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFN Predict reactive species Full Name: NADPH oxidase 1 Calculated Molecular Weight: 564 aa, 65 kDa Observed Molecular Weight: 59 kDa GenBank Accession Number: BC075014 Gene Symbol: NOX1 Gene ID (NCBI): 27035 RRID: AB_2833043 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y5S8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924