Proteintech, 17800-1-AP, MYB/c-Myb Polyclonal antibody

Size: 20ul / 150ul The MYB/c-Myb (17800-1-AP) by Proteintech is a Polyclonal antibody targeting MYB/c-Myb in WB, IP, ELISA applications with reactivity to human samples 17800-1-AP targets MYB/c-Myb in WB, IF, IP, CoIP, RIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HL-60 cells, Jurkat cells, MOLT-4 cells Positive IP detected in: HL-60 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information The MYB protein is a transcription factor that plays a key role in regulating the proliferation/differentiation of progenitor cells in bone marrow, colonic crypts, and neurogenic niches [PMID:18574464]. It is involved in the regulation of epithelial-to-mesenchymal transition (EMT) and invasion in neuroblastoma, colon carcinoma, and embryonic kidney cells through the upregulation of the transcription repressor Slug [PMID:20622260]. It also a DNA-binding protein that specifically recognize the sequence 5'-YAAC[GT]G-3', and plays an important role in the control of proliferation and differentiation of hematopoietic progenitor cells. MYB exists some isoforms with MV 85, 75, 72, 68, 63 and 40 kDa. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12021 Product name: Recombinant human MYB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-356 aa of BC064955 Sequence: MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPELIKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIVNVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPS Predict reactive species Full Name: v-myb myeloblastosis viral oncogene homolog (avian) Calculated Molecular Weight: 640 aa, 72 kDa Observed Molecular Weight: 40-50 kDa, 72-80 kDa GenBank Accession Number: BC064955 Gene Symbol: c-Myb Gene ID (NCBI): 4602 RRID: AB_2148029 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P10242 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.